PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_101987g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 444aa    MW: 50637 Da    PI: 9.7159
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_101987g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.5e-14453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW  eEd ll  +vk++G++ W++++++m+  + R +k+c +rw +yl
   MA_101987g0010  4 RQRWRSEEDSLLHAYVKRYGPREWNLVSQRMNkaLDRDPKSCAERWKNYL 53
                     89**********************************************97 PP

2Myb_DNA-binding27.48e-0959104148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+ +++E+ l + + +++G++ Wk+Ia+ ++ g t+k +  +w  y+
   MA_101987g0010  59 KGSLSEDEQRLVISLQAKYGNR-WKKIAAQVP-GTTAKRLSKWWEVYR 104
                      57789*****************.*********.*******99998886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.638157IPR017930Myb domain
SMARTSM007172.2E-11355IPR001005SANT/Myb domain
SuperFamilySSF466893.59E-194100IPR009057Homeodomain-like
CDDcd001674.98E-8653No hitNo description
Gene3DG3DSA:1.10.10.603.0E-18660IPR009057Homeodomain-like
PfamPF139215.6E-13768No hitNo description
SMARTSM007172.3E-758106IPR001005SANT/Myb domain
PROSITE profilePS5129415.3558108IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-1261103IPR009057Homeodomain-like
CDDcd001677.19E-563103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MKERQRWRSE EDSLLHAYVK RYGPREWNLV SQRMNKALDR DPKSCAERWK NYLKPGIKKG  60
SLSEDEQRLV ISLQAKYGNR WKKIAAQVPG TTAKRLSKWW EVYREKQDKV KDRKERIVAD  120
SANTIEEGKY DHILETFAEK YMQNQKQLAT SSSCNLPTIA AMPSGLPPPI SFSMPTNSTP  180
DFIHFAIPSA STPTTCSFGA PIPCLPPWMS NRPNSNSAHG SGTEAFLHSS SLSKSSPSSS  240
SSPSVTLSLS PSSSTPVMSA NTASACSSWM QDTARQSSEN NVSGDSEAAK DKNRGNSHVQ  300
MPSMDPSKSA ASHQAAADQG VIKQEISVFF QHCRELEERQ QSWSMHKKET GWRLKRLEQQ  360
LEAEKARKRR EKMEEIESKV RALREEEHLY LDRLESDYRD QLSRIHRDAE IKEARVMEMW  420
TAKHVQLTKF FEQMVHRHDP HKSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C5e-15792789C-Myb DNA-Binding Domain
1mse_C5e-15792789C-Myb DNA-Binding Domain
1gv2_A6e-15792789MYB PROTO-ONCOGENE PROTEIN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1366371RKRREK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1127510.0BT112751.1 Picea glauca clone GQ03320_G13 mRNA sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP50961421
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.18e-93MYB family protein